PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_019884-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 506aa    MW: 58697.9 Da    PI: 8.9456
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_019884-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-17449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+ +G+++W++Ia++++ gR++k+c++rw++ 
    NNU_019884-RA  4 RGHWRPSEDEKLRELVEHYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding521.6e-165699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r ++T+eE+e+l+   + +G++ W+ Iar ++ gRt++ +k++w+ 
    NNU_019884-RA 56 RSPFTEEEEERLIASQRIHGNR-WAVIARLFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

3Myb_DNA-binding57.43.4e-18271316147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W ++Ede+l ++v+++G+++Wk+Ia++++ gR++k+c++rw++ 
    NNU_019884-RA 271 RGHWRPDEDEKLGELVERYGPHNWKAIAEKLP-GRSGKSCRLRWFNQ 316
                      899*****************************.***********996 PP

4Myb_DNA-binding48.81.6e-15323366146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l+   + +G++ W+ Iar ++ gRt++ +k++w+ 
    NNU_019884-RA 323 RSPFTEEEEERLLASQRVYGNR-WAVIARLFP-GRTDNAVKNHWHV 366
                      789*******************.*********.***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.201154IPR017930Myb domain
SMARTSM007172.6E-15352IPR001005SANT/Myb domain
SuperFamilySSF466891.72E-28497IPR009057Homeodomain-like
PfamPF002493.6E-17449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-27557IPR009057Homeodomain-like
CDDcd001671.17E-12748No hitNo description
PROSITE profilePS5129420.08155105IPR017930Myb domain
SMARTSM007177.3E-1555103IPR001005SANT/Myb domain
PfamPF002493.6E-135698IPR001005SANT/Myb domain
CDDcd001672.28E-105898No hitNo description
Gene3DG3DSA:1.10.10.601.5E-1958103IPR009057Homeodomain-like
PROSITE profilePS5129424.92266321IPR017930Myb domain
SMARTSM007177.3E-15270319IPR001005SANT/Myb domain
SuperFamilySSF466897.49E-29271364IPR009057Homeodomain-like
PfamPF002492.1E-17271316IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-26272324IPR009057Homeodomain-like
CDDcd001671.20E-12274315No hitNo description
PROSITE profilePS5129419.302322372IPR017930Myb domain
SMARTSM007172.7E-14322370IPR001005SANT/Myb domain
PfamPF002492.4E-12323365IPR001005SANT/Myb domain
CDDcd001676.88E-10325365No hitNo description
Gene3DG3DSA:1.10.10.606.1E-19325371IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MCTRGHWRPS EDEKLRELVE HYGPHNWNAI AEKLQGRSGK SCRLRWFNQL DPRINRSPFT  60
EEEEERLIAS QRIHGNRWAV IARLFPGRTD NAVKNHWHVI MARRSKERSR LYTKRAVQAL  120
INERKSLSKQ QMNTQMGLSN LASLVQNSSC GKYGNPPFMK SYLHDHKALH PDIHGCCTRL  180
NEDRNSPVEF YDFLQVNSSS NGSEVIDSPR RDDEEVEQEA EDKENNPLEL DSIPNFYKLS  240
TFPEEACSGQ TKPNISITRN TGKFIRIMCT RGHWRPDEDE KLGELVERYG PHNWKAIAEK  300
LPGRSGKSCR LRWFNQLDPR INRSPFTEEE EERLLASQRV YGNRWAVIAR LFPGRTDNAV  360
KNHWHVIVAR RCKERSRFYG KRAAQMLINE AKSLLKQDVN LNDEPSDFAS LAQKYYQRHL  420
SPSIQSHLLC PKEYIHPEIP RFCTKIADGN NPIQFYDFLQ GNTSSNGSEV VDHERRDEQE  480
VVQKSNKQER KAGVAFIDFL SVGASS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-3123725108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7112878e-91KP711287.1 Betula platyphylla MYB transcription factor 3 (MYB3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276312.11e-177PREDICTED: myb-related protein B-like
TrEMBLA0A0H4CRL41e-103A0A0H4CRL4_BETPL; MYB transcription factor 3
STRINGVIT_17s0000g01890.t011e-100(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.17e-80myb domain protein 52